Thiol is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2026-03-17. Where a claim depends on a specific study, the study is described rather than over-claimed.
Glutathione is a small tripeptide built from glutamate, cysteine, and glycine. The peptide bond between glutamate and cysteine uses the gamma-carboxyl group, a linkage that resists ordinary peptidases. Cells make it in two ATP-dependent steps: gamma-glutamylcysteine synthetase joins glutamate and cysteine, then glutathione synthetase adds glycine. The pathway is feedback-inhibited by glutathione itself, so intracellular levels tend to stay within a narrow range. Because cysteine is often limiting, sulfur amino acid supply influences how much glutathione a cell can produce.
In its reduced form, glutathione carries a sulfhydryl group that can donate electrons. This property lets it act as a major cellular antioxidant and redox buffer. Glutathione peroxidase uses it to reduce hydrogen peroxide and lipid peroxides, while glutathione reductase regenerates the reduced form using NADPH. The ratio of reduced glutathione to glutathione disulfide is widely used as an indicator of oxidative stress, though the ratio changes with compartment, cell type, and sample handling. Oxidized glutathione can also form mixed disulfides with proteins, affecting their activity.
Glutathione supports detoxification by conjugating reactive electrophiles through glutathione S-transferases. The resulting conjugates are processed and exported, often after further metabolism. It also stores cysteine, transports amino acids across membranes through the gamma-glutamyl cycle, and assists in the maturation of iron-sulfur clusters and some prostaglandins. In plants, animals, and many microbes, the molecule appears in similar roles, but concentrations vary enormously between tissues. Liver, kidney, and red blood cells tend to contain high amounts, while blood plasma contains much less.
Cells synthesize glutathione through two ATP-dependent enzymatic steps. The first step combines glutamate and cysteine to form gamma-glutamylcysteine, catalyzed by glutamate-cysteine ligase. The second step adds glycine, producing the complete tripeptide, catalyzed by glutathione synthetase. Glutathione itself can inhibit the first enzyme, providing negative feedback when levels are high. Because cysteine is often limiting, its availability influences how quickly the pathway proceeds. These reactions occur in the cytosol, and the resulting glutathione can be distributed to other compartments.
Glutathione functions in redox balance, detoxification, and sulfur amino acid storage. It participates in reactions that help maintain ascorbate and protein thiol status. The molecule serves as a cofactor for several enzymes, including glutathione peroxidases and glutathione S-transferases. These enzymes reduce peroxides and conjugate electrophiles, respectively. Glutathione also contributes to the metabolism of xenobiotics and to the transport of cysteine between tissues. How interorgan transport and tissue-specific regulation shape whole-body pools remains an active area of study.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. Its cysteine residue carries a thiol group, which allows the molecule to participate in reduction and oxidation reactions. The compound exists in most living cells, where the reduced form, often abbreviated GSH, is usually more abundant than the oxidized disulfide form, GSSG. Intracellular concentrations are commonly in the millimolar range, while extracellular concentrations are much lower. This uneven distribution supports its role as a major cellular redox buffer.
| Property | Value | Notes |
|---|---|---|
| Chemical formula | C10H17N3O6S | Refers to the reduced form |
| Molar mass | 307.32 g/mol | Calculated for the neutral molecule |
| Appearance | White crystalline powder | Often hygroscopic; protect from moisture |
| Water solubility | Soluble in water | Reported values vary with purity and form |
| Alternative names | GSH, reduced glutathione | GSH specifies the thiol form |
Within cells, glutathione serves as a cofactor for glutathione peroxidases and glutathione S-transferases. These enzymes reduce hydrogen peroxide and organic peroxides or conjugate electrophilic compounds to the thiol group. The resulting conjugates can be exported and processed through mercapturic acid pathways. Glutathione also contributes to protein thiol homeostasis and to recycling of other antioxidants such as ascorbate. Its precise roles vary by tissue, and many regulatory effects observed in laboratory systems remain difficult to quantify in whole organisms.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. It occurs in nearly all living cells, with highest concentrations in liver, kidney, and red blood cells, and exists in reduced (GSH) and oxidized disulfide (GSSG) forms. The cysteine thiol group enables reversible oxidation and reduction reactions. This property makes glutathione a central participant in cellular redox balance. The balance between these forms is often used as an indicator of oxidative stress.
Glutathione synthesis proceeds in two ATP-dependent steps catalyzed by glutamate-cysteine ligase and glutathione synthetase. The first step joins glutamate and cysteine to form gamma-glutamylcysteine and is generally rate-limiting. The second step adds glycine to complete the tripeptide. Cysteine availability, feedback inhibition by glutathione, and oxidative conditions influence flux through this pathway. The pathway is conserved across many organisms, and degradation by gamma-glutamyl transpeptidase and related peptidases recycles amino acids for new synthesis.
Glutathione supports several cellular processes beyond direct antioxidant action. It serves as a cofactor for glutathione peroxidase and glutathione S-transferase enzymes, which reduce peroxides and conjugate electrophiles, respectively. The molecule also acts as a reservoir of cysteine, an amino acid that can limit protein synthesis and redox signaling. In human nutrition, oral glutathione is sold as a supplement, but how much intact glutathione reaches tissues after ingestion remains an active research question. Clinical claims about supplementation are not uniformly supported by controlled trials.
Glutathione is a small tripeptide built from glutamic acid, cysteine, and glycine. Its peptide bond between glutamate and cysteine involves the gamma-carboxyl group rather than the usual alpha-carboxyl group. This structure gives the molecule a reactive thiol on the cysteine residue. The reduced form, often abbreviated GSH, is the predominant intracellular species in many cell types. Because the thiol can donate electrons, glutathione participates in redox chemistry and in the conjugation of reactive molecules.
At the end of the electrophoretic separation, all proteins are sorted by size and can then be analyzed by other methods, e. g. protein staining such as Coomassie staining (most common and easy to use), silver staining (highest sensitivity), stains all staining, Amido black 10B staining, Fast green FCF staining, fluorescent stains such as epicocconone stain and SYPRO orange stain, and immunological detection such as the Western Blot. The fluorescent dyes have a comparatively higher linearity between protein quantity and color intensity of about three orders of magnitude above the detection limit (the quantity of protein that can be estimated by color intensity). When using the fluorescent protein dye trichloroethanol, a subsequent protein staining is omitted if it was added to the gel solution and the gel was irradiated with UV light after electrophoresis. In Coomassie staining, gel is fixed in a 50% ethanol 10% glacial acetic acid solution for 1 hr. Then the solution is changed for fresh one and after 1 to 12 hrs gel is changed to a staining solution (50% methanol, 10% glacial acetic acid, 0.1% coomassie brilliant blue) followed by destaining changing several times a destaining solution of 40% methanol, 10% glacial acetic acid.
=== GDGT-0 === GDGT-0 has zero cyclopentane moieties and is the most ubiquitous isoGDGT synthesized by archaea. Halophilic archaea are the only group of archaea not known to produce GDGT-0. Carbon isotope analyses and association with sites of anaerobic methane oxidation suggest that GDGT-0 is produced via methanotrophs. In microbiology literature not dealing with the geological record, GDGT-0 is sometimes referred to as caldarchaeol.
== External links == polymer statistical mechanics A topological problem in polymer physics: configurational and mechanical properties of a random walk enclosing a constant are D. Shortle and M. Ackerman, Persistence of native-like topology in a denatured protein in 8 M urea, Science 293 (2001), pp. 487–489 Sample chapter "Conformations, Solutions, and Molecular Weight" from "Polymer Science & Technology" courtesy of Prentice Hall Professional publications
== Side effects == During treatment, gastrointestinal disorders can be observed: dyspepsia, nausea, vomiting, diarrhea . These disorders generally regress with the simple decrease in the dose taken, or with the temporary suspension of the treatment. Other adverse events related to hypersensitivity reactions have also been reported : among these skin rashes, skin rash, fever, arthralgia (joint pain). Rare cases of agranulocytosis have also been reported in medical literature. The rarity of the latter adverse effect led several authors to conclude that perhaps there could have been methodological errors in risk assessments.
Sources: en.wikipedia.org
Treatment for thalassemia depends on the severity of the disease. People with thalassemia traits (thalassemia minor or non transfusion dependent thalassemia), may not require medical or follow-up care after the initial diagnosis is made. Occasionally transfusions may be necessary particularly around childbirth, surgery, or if other conditions provoke anemia. A folic acid supplement may also be recommended. For those with severe forms of thalassemia (thalassemia major, or transfusion-dependent thalassemia), the three principal treatments are red blood cell transfusions to relieve anemia, iron chelation to mitigate the side effects of transfusion, and folic acid supplementation to encourage the growth of new blood cells. Other forms of treatment available depending on individual circumstances.
== Death and legacy == Boyd Orr died on 25 June 1971 in Brechin, Scotland; he was 90 years old. His grave is at Stracathro Kirkyard, Angus. The University of Glasgow's Boyd Orr Building and the Boyd Orr Centre for Population and Ecosystem Health are named after him, and the university's Hunterian Museum holds his Nobel Peace Prize medal. There is a street named for Boyd Orr in his home town of Kilmaurs in Ayrshire, as well as others in Aberdeen, Brechin, Laurencekirk, Penicuik, Saltcoats and Strathaven. There is also a road named after him in Harare, Zimbabwe.
==== 9 April ==== Hezbollah said that it had halted attacks on Israel and on Israeli soldiers in Lebanon. However, in the early hours of the day, it claimed responsibility for a rocket attack on northern Israel, stating that attacks would continue until Israel stopped striking Lebanese territories, regardless of the ceasefire. Hezbollah struck Kiryat Shmona, Taibe, and Manara. Despite the agreement to open the Strait of Hormuz, it remains "effectively closed", with Iran limiting the number of ships that can cross and charging tolls of over $1 million per ship, or even $1 million per barrel. Only four ships carrying dry cargo (and thus not oil or gas tankers) managed to pass through Hormuz on the first day of the truce, with the daily average being of nine ships during the war. Drones attacked vital infrastructure in Kuwait, prompting the country to respond by fending them off.
Human physiology is the study of how the human body functions. This includes the mechanical, physical, bioelectrical, and biochemical functions of humans in good health, from organs to the cells of which they are composed. The human body consists of many interacting systems of organs. These interact to maintain homeostasis, keeping the body in a stable state with safe levels of substances such as sugar and oxygen in the blood. Each system contributes to homeostasis, of itself, other systems, and the entire body. Some combined systems are referred to by joint names. For example, the nervous system and the endocrine system operate together as the neuroendocrine system. The nervous system receives information from the body, and transmits this to the brain via nerve impulses and neurotransmitters. At the same time, the endocrine system releases hormones, such as to help regulate blood pressure and volume. Together, these systems regulate the internal environment of the body, maintaining blood flow, posture, energy supply, temperature, and acid balance (pH).
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
Sources: en.wikipedia.org
It is a tripeptide of glutamate, cysteine, and glycine. The glutamate-cysteine bond is unusual because it forms through the gamma-carboxyl group.
It reflects the balance between oxidant exposure and antioxidant capacity. The ratio is not a direct clinical diagnosis and depends on the tissue and sample method.
No. It also participates in detoxification, amino acid transport, and protein modification. Its roles vary by cell type and compartment.
Glutathione is built from three amino acids: glutamate, cysteine, and glycine. The linkage involves the gamma-carboxyl group of glutamate rather than the alpha-carboxyl group, which is unusual for peptides. This structure protects the bond from some common peptidases.