glutathione synthetase comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2025-09-26. Where a claim depends on a specific study, the study is described rather than over-claimed.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. Its cysteine residue carries a thiol group, which allows the molecule to participate in reduction and oxidation reactions. The compound exists in most living cells, where the reduced form, often abbreviated GSH, is usually more abundant than the oxidized disulfide form, GSSG. Intracellular concentrations are commonly in the millimolar range, while extracellular concentrations are much lower. This uneven distribution supports its role as a major cellular redox buffer.
Cells synthesize glutathione through two ATP-dependent enzymatic steps. The first step combines glutamate and cysteine to form gamma-glutamylcysteine, catalyzed by glutamate-cysteine ligase. The second step adds glycine, producing the complete tripeptide, catalyzed by glutathione synthetase. Glutathione itself can inhibit the first enzyme, providing negative feedback when levels are high. Because cysteine is often limiting, its availability influences how quickly the pathway proceeds. These reactions occur in the cytosol, and the resulting glutathione can be distributed to other compartments.
Glutathione functions in redox balance, detoxification, and sulfur amino acid storage. It participates in reactions that help maintain ascorbate and protein thiol status. The molecule serves as a cofactor for several enzymes, including glutathione peroxidases and glutathione S-transferases. These enzymes reduce peroxides and conjugate electrophiles, respectively. Glutathione also contributes to the metabolism of xenobiotics and to the transport of cysteine between tissues. How interorgan transport and tissue-specific regulation shape whole-body pools remains an active area of study.
Biosynthesis proceeds in two ATP-dependent steps. First, glutamate-cysteine ligase joins glutamate and cysteine. Second, glutathione synthetase adds glycine to the intermediate. The pathway is regulated by cysteine availability, enzyme expression, and feedback inhibition by glutathione itself. Liver tissue has a particularly high capacity for synthesis and export. Because the molecule is made inside cells, circulating glutathione reflects a balance of release, uptake, and breakdown rather than simple dietary supply.
Functionally, glutathione supports redox balance by donating electrons and becoming oxidized. It also serves as a cofactor for enzymes such as glutathione peroxidases and glutathione S-transferases. These enzymes participate in peroxide reduction and in conjugation reactions that help process reactive molecules. Separate from antioxidant roles, glutathione can modify protein cysteines through S-glutathionylation, influencing enzyme activity and signaling. Research continues to examine how these chemical roles translate into whole-organism effects.
| Property | Value | Notes |
|---|---|---|
| Chemical formula | C10H17N3O6S | Reduced glutathione (GSH) |
| Molar mass | 307.32 g/mol | Calculated for C10H17N3O6S |
| Appearance | White to off-white powder | Typical solid form |
| Solubility | Water-soluble | Polar tripeptide |
| Common synonyms | GSH; L-glutathione | Gamma-glutamylcysteinylglycine |
Glutathione participates in detoxification reactions, amino acid transport, and the maintenance of protein thiols. It serves as a cofactor for several enzymes, including glutathione peroxidases and glutathione S-transferases. In research literature, altered glutathione status appears in studies of aging, infection, metabolic stress, and environmental exposure. Whether low glutathione is a cause, consequence, or marker of such conditions often remains unresolved. Direct measurement in blood or tissue provides a snapshot, but results depend on sample handling, timing, and the method used.
Glutathione is a small tripeptide made of glutamic acid, cysteine, and glycine. Its cysteine thiol group allows reversible oxidation and reduction, making it central to cellular redox chemistry. The reduced form, often abbreviated GSH, predominates inside most cells, while the oxidized disulfide form, GSSG, forms when two GSH molecules react. The ratio of GSH to GSSG is widely used as an indicator of oxidative stress in laboratory research, though it does not by itself diagnose a clinical condition.
Biosynthesis occurs in two ATP-dependent steps. The enzyme glutamate-cysteine ligase joins glutamate and cysteine, forming gamma-glutamylcysteine; glutathione synthetase then adds glycine to produce the complete tripeptide. Because the peptide bond from glutamate uses the gamma-carboxyl group, glutathione resists digestion by many ordinary peptidases. Tissues vary in synthesis capacity, and the liver generally contains high concentrations relative to many other organs. This uneven distribution contributes to organ-specific differences in redox buffering and affects how experimental results are interpreted across tissue types.
Because GSH is central to redox balance, its status is studied in aging, liver disease, neurodegenerative conditions, and metabolic disorders. Observational studies often report lower GSH or higher GSSG in affected tissues, but such associations do not establish that raising glutathione changes disease outcomes. Oral glutathione is digested into amino acids, and whether intact absorption occurs remains debated; precursors such as N-acetylcysteine and cysteine donors are also investigated. Regulatory agencies generally treat glutathione as a dietary supplement, not an approved drug, and clinical claims require evidence from controlled trials.
Glutathione is a small tripeptide composed of glutamate, cysteine, and glycine, with the unusual gamma-glutamyl linkage between glutamate and cysteine. Its cysteine thiol group makes it a major non-enzymatic antioxidant in cells. The reduced form, GSH, predominates in most intracellular compartments, while the oxidized disulfide form, GSSG, is produced when GSH reduces reactive oxygen species. Intracellular concentrations often reach millimolar levels, whereas plasma concentrations are much lower, typically in the low micromolar range. This gradient reflects active synthesis, transport, and consumption rather than passive distribution.
Within cells, glutathione serves as a cofactor for glutathione peroxidases and glutathione S-transferases. These enzymes reduce hydrogen peroxide and organic peroxides or conjugate electrophilic compounds to the thiol group. The resulting conjugates can be exported and processed through mercapturic acid pathways. Glutathione also contributes to protein thiol homeostasis and to recycling of other antioxidants such as ascorbate. Its precise roles vary by tissue, and many regulatory effects observed in laboratory systems remain difficult to quantify in whole organisms.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. It occurs in nearly all living cells, with highest concentrations in liver, kidney, and red blood cells, and exists in reduced (GSH) and oxidized disulfide (GSSG) forms. The cysteine thiol group enables reversible oxidation and reduction reactions. This property makes glutathione a central participant in cellular redox balance. The balance between these forms is often used as an indicator of oxidative stress.
Glutathione synthesis proceeds in two ATP-dependent steps catalyzed by glutamate-cysteine ligase and glutathione synthetase. The first step joins glutamate and cysteine to form gamma-glutamylcysteine and is generally rate-limiting. The second step adds glycine to complete the tripeptide. Cysteine availability, feedback inhibition by glutathione, and oxidative conditions influence flux through this pathway. The pathway is conserved across many organisms, and degradation by gamma-glutamyl transpeptidase and related peptidases recycles amino acids for new synthesis.
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
=== Glucose tolerance === Middle aged (10‐month‐old) mice fed a high fat diet gained body weight and fat mass in the lower parts of their bodies and had impaired glucose tolerance as defined in glucose tolerance tests. Adding α-ketoglutarate to the drinking water of these mice inhibited the development of these changes. These results suggest that drinking the α-ketoglutarate-rich water replenished the otherwise diminished supplies of α-ketoglutarate in middle aged mice; the replenished supply of α-ketoglutarate thereby became available to suppress obesity and improve glucose tolerance. A study in rats feed a low fat or high fat diet for 27 weeks and drinking α-ketoglutarate-rich water for the last 12 weeks of this 27 week period decreased their fat issue masses and increased their whole-body insulin sensitivity as defined in glucose tolerance tests. Rats fed either of these diets but not given α-ketoglutarate-rich water did not show these changes. This study indicates that α-ketoglutarate regulates body fat mass and insulin sensitivity in rats as well as mice.
First, in a series of Commission decisions, Google and Amazon were fined for competition violations. In the Google Shopping case, the Commission fined Google €2.4 billion for giving preference to its own shopping results over others in Google's search, leading to huge increases in traffic for Google over rivals. In the Google Android case the Commission fined Alphabet Inc (by then Google's rebranded parent name) €4.34 billion, or 4.5% of worldwide turnover, for paying phone manufacturers to pre-install its apps, such as Google search or Chrome, as a condition to license its app marketplace Google Play. In the Google AdSense case, the Commission fined Google €1.49 billion for stopping third-party websites displaying their adverts in Google's embedded search widgets, given that it was dominant in the ad market, and unfairly excluding competitors from results. In the Amazon Marketplace case an investigation for abuse of dominant position was launched for Amazon using other traders' data to benefit its own retail business, and preferencing itself in its "Buy Box" and in access to "Prime" seller status. This was settled after Amazon committed in 2022 "not to use non-public data relating to, or derived from, the independent sellers' activities on its marketplace, for its retail business", and to not discriminate against third parties in its Buy Box and Prime services. The Digital Markets Act codifies many of these standards.
Dermatomyositis (DM) is a group of systemic autoimmune inflammatory diseases primarily affecting the skin and skeletal muscles. Its symptoms are generally a skin rash and worsening muscle weakness over time. These may occur suddenly or develop over months. Other symptoms may include weight loss, fever, lung inflammation, or light sensitivity. Complications may include calcium deposits in muscles or skin. Distinct myositis-specific autoantibodies (MSA) define clinically and pathologically distinct DM subtypes, each associated with characteristic disease manifestations, prognosis, and treatment response. Eighty percent of adults and sixty percent of children with juvenile dermatomyositis have a MSA. These autoantibodies, produced by locally infiltrating plasma cells, can enter various cell types and disrupt the function of their target autoantigens, inducing cellular damage and inflammation that directly drive disease pathogenesis. Dermatomyositis may develop as a paraneoplastic syndrome associated with several malignancies, in which tumors harbor genetic alterations, including somatic mutations, in genes encoding the specific autoantigens targeted by the patient's corresponding autoantibodies. It is known to be associated with several viruses, especially coxsackievirus, but no definitive causal link has been found. Diagnosis is typically based on some combination of symptoms, blood tests, electromyography, and muscle biopsies.
Sources: en.wikipedia.org
Portland cement, a form of hydraulic cement, is by far the most common type of cement in general use around the world. The most common use for Portland cement is to make concrete. Portland cement may be grey or white.
=== Anterior abdominal aponeuroses === The anterior abdominal aponeuroses are located just superficial to the rectus abdominis muscle. It has for its borders the external oblique, pectoralis muscles, and the latissimus dorsi.
==== New Zealand ==== Since April 2024, pseudoephedrine has been classified as a restricted (pharmacist-only) drug in the Misuse of Drugs Act 1975 which allows the purchase of medicines containing pseudoephedrine from a pharmacist without a prescription. Pseudoephedrine, ephedrine, and any product containing these substances, e.g. cold and flu medicines, were first classified in October 2004 as Class C Part III (partially exempted) controlled drugs, due to being the principal ingredient in methamphetamine. New Zealand Customs and police officers continued to make large interceptions of precursor substances believed to be destined for methamphetamine production. On 9 October 2009, Prime Minister John Key announced pseudoephedrine-based cold and flu tablets would become prescription-only drugs and reclassified as a class B2 drug. The law was amended by The Misuse of Drugs Amendment Bill 2010, which passed in August 2011. In November 2023, the National-led coalition government announced that the sale of cold medication containing pseudoephedrine would be allowed (as part of the coalition agreement between the National and ACT parties).
Adenylyl-sulfate reductase (glutathione) (EC 1.8.4.9) is an enzyme that catalyzes the chemical reaction AMP + sulfite + glutathione disulfide ⇌ {\displaystyle \rightleftharpoons } adenylyl sulfate + 2 glutathione The 3 substrates of this enzyme are adenosine monophosphate, sulfite, and glutathione disulfide, whereas its two products are adenylyl sulfate and glutathione. This enzyme belongs to the family of oxidoreductases, specifically those acting on a sulfur group of donors with a disulfide as acceptor. The systematic name of this enzyme class is AMP,sulfite:glutathione-disulfide oxidoreductase (adenosine-5'-phosphosulfate-forming). Other names in common use include 5'-adenylylsulfate reductase (also used for, internal_xref(ec_num(1,8,99,2))), AMP,sulfite:oxidized-glutathione oxidoreductase, (adenosine-5'-phosphosulfate-forming), and plant-type 5'-adenylylsulfate reductase. In plants, APS is reduced by the plastidic enzyme APS reductase (APR; EC 1.8.4.9) in the presence of physiological concentrations of reduced glutathione (GSH), which acts as an electron donor.
Enteroglucagon is a proglucagon-derived peptide or enteroendocrine cells derived peptide in the small intestine. Preproglucagon undergoes post translational modification to release glucagon-like peptides (GLP-1 and GLP-2) and other molecules derived from L-cells of intestine. GLP-1 is derived from a class of intestinal hormones called incretin and the molecule exists in two forms GLP-1(7-37) and GLP-1(7-36) amide. GLP-1 form of incretin starts circulating in response to a high blood glucose level. Incretin effect is a negative feedback loop between glucose and insulin level, it promotes insulin release from beta cells of pancreas islet and suppresses glucagon when the glucose level is high. In vertebrate mammals, GLP-2 sequences are highly conversed in the intestine. The molecule functions as a part of adaptive response, such that contributes intestinal growth, proliferation effect, intestinal dilation (increases the mucosal blood flow) and reduces the chance of apoptosis.
Sources: en.wikipedia.org
Glutathione is built from three amino acids: glutamate, cysteine, and glycine. The linkage involves the gamma-carboxyl group of glutamate rather than the alpha-carboxyl group, which is unusual for peptides. This structure protects the bond from some common peptidases.
It is present in nearly all cells, with notable amounts in the liver, kidneys, and red blood cells. The highest intracellular concentrations are usually in the millimolar range. Levels differ by tissue, age, and physiological state.
It is not classified as an essential nutrient because cells can synthesize it from amino acids. Dietary sources exist, but their contribution to tissue pools is not fully established. The body's production depends on enzyme activity and precursor availability.
Glutathione is a sulfur-containing tripeptide made from glutamate, cysteine, and glycine. It is found in most cells and participates in redox balance and detoxification reactions.